General Information

  • ID:  hor006101
  • Uniprot ID:  P01278
  • Protein name:  Glicentin-related polypeptide
  • Gene name:  gcg1
  • Organism:  Lophius americanus (American angler) (Anglerfish)
  • Family:  Glucagon family
  • Source:  Animal
  • Expression:  Produced in the A cells of the islets of Langerhans in response to a drop in blood sugar concentration.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Lophius (genus), Lophiidae (family), Lophioidei (suborder), Lophiiformes (order), Eupercaria, Percomorphaceae, Euacanthomorphacea, Acanthomorphata, Ctenosquamata, Eurypterygia, Neoteleostei, Euteleosteomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction; GO:0050896 response to stimulus
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  QEADPSSSLEADSTLKDEPRELSNM
  • Length:  25(26-50)
  • Propeptide:  MKRIHSLAGILLVLGLIQSSCRVLMQEADPSSSLEADSTLKDEPRELSNMKRHSEGTFSNDYSKYLEDRKAQEFVRWLMNNKRSGVAEKRHADGTFTSDVSSYLKDQAIKDFVDRLKAGQVRRE
  • Signal peptide:  MKRIHSLAGILLVLGLIQSSCRVLM
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Glucagon plays a key role in glucose metabolism and homeostasis. Regulates blood glucose by increasing gluconeogenesis and decreasing glycolysis.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P01278-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006101_AF2.pdbhor006101_ESM.pdb

Physical Information

Mass: 317815 Formula: C111H181N31O48S
Absent amino acids: CFGHIVWY Common amino acids: S
pI: 3.73 Basic residues: 2
Polar residues: 7 Hydrophobic residues: 5
Hydrophobicity: -123.6 Boman Index: -8489
Half-Life / Aliphatic Index: 0.8 hour Aliphatic Index: 54.8
Instability Index: 4262 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  7043459
  • Title:  Pancreatic preproglucagon cDNA contains two glucagon-related coding sequences arranged in tandem.
  • PubMed ID:  6165720
  • Title:  Pancreatic pre-proglucagons are encoded by two separate mRNAs.
  • PubMed ID:  3058456
  • Title:  Pancreatic proglucagon processing: isolation and structures of glucagon and glucagon-like pe